SCOPe 2.01: Domain d3a58d_: 3a58 D:

Lineage for d3a58d_ (3a58 D:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein automated matches [190047] (13 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187069] (2 PDB entries)

8. Domain d3a58d_: 3a58 D: [171748]
   automated match to d1ow3b_
   complexed with gnp, mg, po4

Details for d3a58d_

PDB Entry: 3a58, 2.6 Å

PDB Description: crystal structure of sec3p - rho1p complex from saccharomyces cerevisiae

PDB Compounds: (D:) GTP-binding protein RHO1

SCOPe Domain Sequences for d3a58d_:

Sequence; same for both SEQRES and ATOM records:

>d3a58d_ c.37.1.8 (D:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sirrklvivgdgacgktcllivnskgqfpevyvptvfenyvadvevdgrrvelalwdtag
qedydrlrplsypdsnvvlicfsidlpdslenvqekwiaevlhfcqgvpiilvgckvdlr
ndpqtieqlrqegqqpvtsqegqsvadqigatgyyecsaktgygvrevfeaatraslm

Timeline for d3a58d_:

• d3a58d_ is new in SCOPe 2.01-stable
  
• d3a58d_ appears in SCOPe 2.02
  
• d3a58d_ appears in the current release, SCOPe 2.08