Class a: All alpha proteins [46456] (284 folds) |
Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
Superfamily a.104.1: Cytochrome P450 [48264] (2 families) |
Family a.104.1.0: automated matches [191509] (1 protein) not a true family |
Protein automated matches [190847] (10 species) not a true protein |
Species Pseudonocardia autotrophica [TaxId:2074] [189387] (4 PDB entries) |
Domain d3a50e_: 3a50 E: [171741] automated match to d1jipa_ complexed with act, ca, gol, hem, vd3; mutant |
PDB Entry: 3a50 (more details), 2.05 Å
SCOPe Domain Sequences for d3a50e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3a50e_ a.104.1.0 (E:) automated matches {Pseudonocardia autotrophica [TaxId: 2074]} altttgteqhdlfsgtfwqnphpayaalraedpvrklalpdgpvwlltryadvreafvdp rlskdwrhrlpedqradmpatptpmmilmdppdhtrlrklvgrsftvrrmnelepritei adgllaglptdgpvdlmreyafqipvqvicellglpaedrddfsawssvlvddspaddkn aamgklhgylsdllerkrtepddallssllavsdmdgdrlsqeelvamamllliaghett vnligngvlallthpdqrkllaedpslissaveeflrfdspvsqapirftaedvtysgvt ipagemvmlglaaanrdadwmpepdrlditrdasggvffghgihfclgaqlarlegrvai grlfadrpelalavgldelvyrrstlvrglsrmpvtmgprs
Timeline for d3a50e_:
View in 3D Domains from other chains: (mouse over for more information) d3a50a_, d3a50b_, d3a50c_, d3a50d_ |