![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
![]() | Superfamily a.104.1: Cytochrome P450 [48264] (2 families) ![]() |
![]() | Family a.104.1.0: automated matches [191509] (1 protein) not a true family |
![]() | Protein automated matches [190847] (99 species) not a true protein |
![]() | Species Pseudonocardia autotrophica [TaxId:2074] [189387] (8 PDB entries) |
![]() | Domain d3a50d_: 3a50 D: [171740] automated match to d1jipa_ complexed with act, ca, gol, hem, vd3; mutant |
PDB Entry: 3a50 (more details), 2.05 Å
SCOPe Domain Sequences for d3a50d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3a50d_ a.104.1.0 (D:) automated matches {Pseudonocardia autotrophica [TaxId: 2074]} altttgteqhdlfsgtfwqnphpayaalraedpvrklalpdgpvwlltryadvreafvdp rlskdwrhrlpedqradmpatptpmmilmdppdhtrlrklvgrsftvrrmnelepritei adgllaglptdgpvdlmreyafqipvqvicellglpaedrddfsawssvlvddspaddkn aamgklhgylsdllerkrtepddallssllavsdmdgdrlsqeelvamamllliaghett vnligngvlallthpdqrkllaedpslissaveeflrfdspvsqapirftaedvtysgvt ipagemvmlglaaanrdadwmpepdrlditrdasggvffghgihfclgaqlarlegrvai grlfadrpelalavgldelvyrrstlvrglsrmpvtmgprs
Timeline for d3a50d_:
![]() Domains from other chains: (mouse over for more information) d3a50a_, d3a50b_, d3a50c_, d3a50e_ |