Lineage for d1uwoa_ (1uwo A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2710067Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2710100Family a.39.1.2: S100 proteins [47478] (2 proteins)
    dimer: subunits are made of two EF-hands
  6. 2710101Protein Calcyclin (S100) [47479] (17 species)
  7. 2710282Species Human (Homo sapiens), s100b [TaxId:9606] [47483] (11 PDB entries)
  8. 2710300Domain d1uwoa_: 1uwo A: [17174]

Details for d1uwoa_

PDB Entry: 1uwo (more details)

PDB Description: calcium form of human s100b, nmr, 20 structures
PDB Compounds: (A:) s100b

SCOPe Domain Sequences for d1uwoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uwoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100b [TaxId: 9606]}
selekamvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmetl
dndgdgecdfqefmafvamvttacheffehe

SCOPe Domain Coordinates for d1uwoa_:

Click to download the PDB-style file with coordinates for d1uwoa_.
(The format of our PDB-style files is described here.)

Timeline for d1uwoa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1uwob_