Class a: All alpha proteins [46456] (286 folds) |
Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
Superfamily a.104.1: Cytochrome P450 [48264] (2 families) |
Family a.104.1.0: automated matches [191509] (1 protein) not a true family |
Protein automated matches [190847] (45 species) not a true protein |
Species Pseudonocardia autotrophica [TaxId:2074] [189387] (6 PDB entries) |
Domain d3a4zd_: 3a4z D: [171735] automated match to d1jipa_ complexed with act, ca, gol, hem; mutant |
PDB Entry: 3a4z (more details), 2.2 Å
SCOPe Domain Sequences for d3a4zd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3a4zd_ a.104.1.0 (D:) automated matches {Pseudonocardia autotrophica [TaxId: 2074]} altttgteqhdlfsgtfwqnphpayaalraedpvrklalpdgpvwlltryadvreafvdp rlskdwrhrlpedqradmpatptpmmilmdppdhtrlrklvgrsftvrrmnelepritei adgllaglptdgpvdlmreyafqipvqvicellglpaedrddfsawssvlvddspaddkn aamgklhgylsdllerkrtepddallssllavsdmdgdrlsqeelvamamllliaghett vnligngvlallthpdqrkllaedpslissaveeflrfdspvsqapirftaedvtysgvt ipagemvmlglaaanrdadwmpepdrlditrdasggvffghgihfclgaqlarlegrvai grlfadrpelalavgldelvyrrstlvrglsrmpvtmgprs
Timeline for d3a4zd_:
View in 3D Domains from other chains: (mouse over for more information) d3a4za_, d3a4zb_, d3a4zc_, d3a4ze_ |