Lineage for d1cfpb_ (1cfp B:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 3180Fold a.39: EF Hand-like [47472] (3 superfamilies)
  4. 3181Superfamily a.39.1: EF-hand [47473] (7 families) (S)
  5. 3199Family a.39.1.2: S100 proteins [47478] (1 protein)
  6. 3200Protein Calcyclin (S100) [47479] (9 species)
  7. 3201Species Cow (Bos taurus), s100b [TaxId:9913] [47482] (2 PDB entries)
  8. 3204Domain d1cfpb_: 1cfp B: [17173]

Details for d1cfpb_

PDB Entry: 1cfp (more details)

PDB Description: s100b (s100beta) nmr data was collected from a sample of calcium free protein at ph 6.3 and a temperature of 311 k and 1.7-6.9 mm concentration, 25 structures
PDB Compounds: (B:)

SCOP Domain Sequences for d1cfpb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cfpb_ a.39.1.2 (B:) Calcyclin (S100) {Cow (Bos taurus), s100b}
mselekavvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmet
ldsdgdgecdfqefmafvamittacheffehe

SCOP Domain Coordinates for d1cfpb_:

Click to download the PDB-style file with coordinates for d1cfpb_.
(The format of our PDB-style files is described here.)

Timeline for d1cfpb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1cfpa_