Lineage for d3a4sd_ (3a4s D:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1637451Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1637452Superfamily d.15.1: Ubiquitin-like [54236] (9 families) (S)
  5. 1638517Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 1638518Protein automated matches [190233] (10 species)
    not a true protein
  7. 1638593Species Mouse (Mus musculus) [TaxId:10090] [189205] (5 PDB entries)
  8. 1638598Domain d3a4sd_: 3a4s D: [171727]
    Other proteins in same PDB: d3a4sa_, d3a4sb_
    automated match to d1wm2a_
    protein/RNA complex

Details for d3a4sd_

PDB Entry: 3a4s (more details), 2.7 Å

PDB Description: The crystal structure of the SLD2:Ubc9 complex
PDB Compounds: (D:) NFATC2-interacting protein

SCOPe Domain Sequences for d3a4sd_:

Sequence, based on SEQRES records: (download)

>d3a4sd_ d.15.1.0 (D:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
elrlrvqgkekhqmleislspdsplkvlmshyeeamglsghklsfffdgtklsgkelpad
lglesgdlievw

Sequence, based on observed residues (ATOM records): (download)

>d3a4sd_ d.15.1.0 (D:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
elrlrvqgkekhqmleislspsplkvlmshyeealsfffdgtklsgkelpaglesgdlie
vw

SCOPe Domain Coordinates for d3a4sd_:

Click to download the PDB-style file with coordinates for d3a4sd_.
(The format of our PDB-style files is described here.)

Timeline for d3a4sd_: