Lineage for d3a4rb1 (3a4r B:341-412)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2933104Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 2933105Protein automated matches [190233] (31 species)
    not a true protein
  7. 2933417Species Mouse (Mus musculus) [TaxId:10090] [189205] (17 PDB entries)
  8. 2933419Domain d3a4rb1: 3a4r B:341-412 [171723]
    Other proteins in same PDB: d3a4ra2, d3a4rb2
    automated match to d1wm2a_
    complexed with edo, so4

Details for d3a4rb1

PDB Entry: 3a4r (more details), 1 Å

PDB Description: The crystal structure of SUMO-like domain 2 in Nip45
PDB Compounds: (B:) NFATC2-interacting protein

SCOPe Domain Sequences for d3a4rb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3a4rb1 d.15.1.0 (B:341-412) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
lrlrvqgkekhqmleislspdsplkvlmshyeeamglsghklsfffdgtklsgkelpadl
glesgdlievwg

SCOPe Domain Coordinates for d3a4rb1:

Click to download the PDB-style file with coordinates for d3a4rb1.
(The format of our PDB-style files is described here.)

Timeline for d3a4rb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3a4rb2