Lineage for d1cfpa_ (1cfp A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2323235Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2323236Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2323269Family a.39.1.2: S100 proteins [47478] (2 proteins)
    dimer: subunits are made of two EF-hands
  6. 2323270Protein Calcyclin (S100) [47479] (17 species)
  7. 2323271Species Cow (Bos taurus), s100b [TaxId:9913] [47482] (26 PDB entries)
  8. 2323310Domain d1cfpa_: 1cfp A: [17172]

Details for d1cfpa_

PDB Entry: 1cfp (more details)

PDB Description: s100b (s100beta) nmr data was collected from a sample of calcium free protein at ph 6.3 and a temperature of 311 k and 1.7-6.9 mm concentration, 25 structures
PDB Compounds: (A:) s100b

SCOPe Domain Sequences for d1cfpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cfpa_ a.39.1.2 (A:) Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 9913]}
mselekavvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmet
ldsdgdgecdfqefmafvamittacheffehe

SCOPe Domain Coordinates for d1cfpa_:

Click to download the PDB-style file with coordinates for d1cfpa_.
(The format of our PDB-style files is described here.)

Timeline for d1cfpa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1cfpb_