Lineage for d3a4ga_ (3a4g A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2005528Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2005529Protein automated matches [190847] (63 species)
    not a true protein
  7. 2005811Species Pseudonocardia autotrophica [TaxId:2074] [189387] (8 PDB entries)
  8. 2005812Domain d3a4ga_: 3a4g A: [171719]
    automated match to d1jipa_
    complexed with hem, pg0

Details for d3a4ga_

PDB Entry: 3a4g (more details), 1.75 Å

PDB Description: Structure of cytochrome P450 vdh from Pseudonocardia autotrophica (trigonal crystal form)
PDB Compounds: (A:) Vitamin D hydroxylase

SCOPe Domain Sequences for d3a4ga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3a4ga_ a.104.1.0 (A:) automated matches {Pseudonocardia autotrophica [TaxId: 2074]}
eqhdlfsgtfwqnphpayaalraedpvrklalpdgpvwlltryadvreafvdprlskdwr
htlpedqradmpatptpmmilmdppdhtrlrklvgrsftvrrmnelepriteiadgllag
lptdgpvdlmreyafqipvqvicellgvpaedrddfsawssvlvddspaddknaamgklh
gylsdllerkrtepddallssllavsdedgdrlsqeelvamamllliaghettvnligng
vlallthpdqrkllaedpslissaveeflrfdspvsqapirftaedvtysgvtipagemv
mlglaaanrdadwmpepdrlditrdasggvffghgihfclgaqlarlegrvaigrlfadr
pelalavgldelvyrestlvrglsrmpvtmgprsa

SCOPe Domain Coordinates for d3a4ga_:

Click to download the PDB-style file with coordinates for d3a4ga_.
(The format of our PDB-style files is described here.)

Timeline for d3a4ga_: