Class a: All alpha proteins [46456] (289 folds) |
Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily) multihelical; 3 layers or orthogonally packed helices |
Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) |
Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins) |
Protein automated matches [190059] (14 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187214] (173 PDB entries) |
Domain d3a40x_: 3a40 X: [171712] automated match to d1ie9a_ complexed with 23r, so4 |
PDB Entry: 3a40 (more details), 1.45 Å
SCOPe Domain Sequences for d3a40x_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3a40x_ a.123.1.1 (X:) automated matches {Human (Homo sapiens) [TaxId: 9606]} dslrpklseeqqriiailldahhktydptysdfcqfrppvrvndgggsvtlelsqlsmlp hladlvsysiqkvigfakmipgfrdltsedqivllkssaievimlrsnesftmddmswtc gnqdykyrvsdvtkaghslelieplikfqvglkklnlheeehvllmaicivspdrpgvqd aalieaiqdrlsntlqtyircrhpppgshllyakmiqkladlrslneehskqyrclsfqp ecsmkltplvlevfg
Timeline for d3a40x_: