SCOPe 2.06: Domain d3a3zx_: 3a3z X:

Lineage for d3a3zx_ (3a3z X:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
   multihelical; 3 layers or orthogonally packed helices

4. Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families)

5. Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)

6. Protein automated matches [190059] (14 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187214] (173 PDB entries)

8. Domain d3a3zx_: 3a3z X: [171711]
   automated match to d1ie9a_
   complexed with 2mv, so4

Details for d3a3zx_

PDB Entry: 3a3z, 1.72 Å

PDB Description: Crystal structure of the human VDR ligand binding domain bound to the synthetic agonist compound 2alpha-methyl-AMCR277A(C23S)

PDB Compounds: (X:) Vitamin D3 receptor

SCOPe Domain Sequences for d3a3zx_:

Sequence; same for both SEQRES and ATOM records:

>d3a3zx_ a.123.1.1 (X:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dslrpklseeqqriiailldahhktydptysdfcqfrppvrvndgggsvtlelsqlsmlp
hladlvsysiqkvigfakmipgfrdltsedqivllkssaievimlrsnesftmddmswtc
gnqdykyrvsdvtkaghslelieplikfqvglkklnlheeehvllmaicivspdrpgvqd
aalieaiqdrlsntlqtyircrhpppgshllyakmiqkladlrslneehskqyrclsfqp
ecsmkltplvlevfg

Timeline for d3a3zx_:

• d3a3zx_ first appeared in SCOPe 2.01
  
• d3a3zx_ appears in SCOPe 2.05
  
• d3a3zx_ appears in SCOPe 2.07
  
• d3a3zx_ appears in the current release, SCOPe 2.08