SCOP 1.73: Domain d1mhoa_: 1mho A:

Lineage for d1mhoa_ (1mho A:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (11 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.2: S100 proteins [47478] (1 protein)
   dimer: subunits are made of two EF-hands

6. Protein Calcyclin (S100) [47479] (17 species)

7. Species Cow (Bos taurus), s100b [TaxId:9913] [47482] (3 PDB entries)

8. Domain d1mhoa_: 1mho A: [17171]
   complexed with ca

Details for d1mhoa_

PDB Entry: 1mho, 2 Å

PDB Description: the 2.0 a structure of holo s100b from bovine brain

PDB Compounds: (A:) s-100 protein

SCOP Domain Sequences for d1mhoa_:

Sequence; same for both SEQRES and ATOM records:

>d1mhoa_ a.39.1.2 (A:) Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 9913]}
selekavvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmetl
dsdgdgecdfqefmafvamittacheff

Timeline for d1mhoa_:

• d1mhoa_ first appeared (with stable ids) in SCOP 1.55, called d1mho__
  
• d1mhoa_ was called d1mho__ in SCOP 1.71
  
• d1mhoa_ appears in SCOP 1.75
  
• d1mhoa_ appears in the current release, SCOPe 2.08