Lineage for d1mho__ (1mho -)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 213166Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 213167Superfamily a.39.1: EF-hand [47473] (9 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 213190Family a.39.1.2: S100 proteins [47478] (1 protein)
    dimer: subunits are made of two EF-hands
  6. 213191Protein Calcyclin (S100) [47479] (15 species)
  7. 213192Species Cow (Bos taurus), s100b [TaxId:9913] [47482] (2 PDB entries)
  8. 213193Domain d1mho__: 1mho - [17171]
    complexed with ca

Details for d1mho__

PDB Entry: 1mho (more details), 2 Å

PDB Description: the 2.0 a structure of holo s100b from bovine brain

SCOP Domain Sequences for d1mho__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mho__ a.39.1.2 (-) Calcyclin (S100) {Cow (Bos taurus), s100b}
selekavvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmetl
dsdgdgecdfqefmafvamittacheff

SCOP Domain Coordinates for d1mho__:

Click to download the PDB-style file with coordinates for d1mho__.
(The format of our PDB-style files is described here.)

Timeline for d1mho__: