Lineage for d1mho__ (1mho -)
- Root: SCOP 1.61
Class a: All alpha proteins [46456] (151 folds) 
Fold a.39: EF Hand-like [47472] (4 superfamilies) Superfamily a.39.1: EF-hand [47473] (8 families) 
Family a.39.1.2: S100 proteins [47478] (1 protein) Protein Calcyclin (S100) [47479] (13 species) 
Species Cow (Bos taurus), s100b [TaxId:9913] [47482] (2 PDB entries) 
Domain d1mho__: 1mho - [17171]
Details for d1mho__
PDB Entry: 1mho (more details), 2 Å
PDB Description: the 2.0 a structure of holo s100b from bovine brain
SCOP Domain Sequences for d1mho__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mho__ a.39.1.2 (-) Calcyclin (S100) {Cow (Bos taurus), s100b}
selekavvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmetl
dsdgdgecdfqefmafvamittacheff
SCOP Domain Coordinates for d1mho__:
Click to download the PDB-style file with coordinates for d1mho__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1mho__:
- d1mho__ first appeared (with stable ids) in SCOP 1.55
- d1mho__ appears in SCOP 1.59
- d1mho__ appears in SCOP 1.63
- d1mho__ appears in the current release, SCOPe 2.08, called d1mhoa_
View in 3D