![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) ![]() the beta-sheet barrel is similarly distorted and capped by a C-terminal helix has transition metal ions bound inside the barrel |
![]() | Family c.1.9.3: Phosphotriesterase-like [51564] (3 proteins) |
![]() | Protein Phosphotriesterase (parathion hydrolase, PTE) [51565] (3 species) |
![]() | Species Agrobacterium tumefaciens [TaxId:358] [141815] (13 PDB entries) Uniprot Q93LD7 32-360 |
![]() | Domain d3a3wa_: 3a3w A: [171709] automated match to d2d2ga1 complexed with co, epl; mutant |
PDB Entry: 3a3w (more details), 1.85 Å
SCOPe Domain Sequences for d3a3wa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3a3wa_ c.1.9.3 (A:) Phosphotriesterase (parathion hydrolase, PTE) {Agrobacterium tumefaciens [TaxId: 358]} tgdlintvrgpipvseagftlthehicassagflrawpeffgsrkalvekavrglrhara agvqtivdvstfdigrdvrllaevsqaadvhivaatglwfdpplsmrmrsveeltqfflr eiqhgiedtgiragiikvattgkatpfqelvlraaaraslatgvpvtthtsasprggeqq aaifeseglspsrvcighsddtddlsyltglaargylvgldrmpysatglegnasalalf strswqtrallikalidrgykdrilvshdwlfgfssyvtnimdvmdrinpdgmafvplrv ipflrekgvppetlagvtvanparflspt
Timeline for d3a3wa_: