Lineage for d3a3wa_ (3a3w A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 968086Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 971605Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 971705Family c.1.9.3: Phosphotriesterase-like [51564] (3 proteins)
  6. 971706Protein Phosphotriesterase (parathion hydrolase, PTE) [51565] (3 species)
  7. 971707Species Agrobacterium tumefaciens [TaxId:358] [141815] (13 PDB entries)
    Uniprot Q93LD7 32-360
  8. 971715Domain d3a3wa_: 3a3w A: [171709]
    automated match to d2d2ga1
    complexed with co, epl; mutant

Details for d3a3wa_

PDB Entry: 3a3w (more details), 1.85 Å

PDB Description: structure of opda mutant (g60a/a80v/s92a/r118q/k185r/q206p/d208g/i260t/g273s) with diethyl 4- methoxyphenyl phosphate bound in the active site
PDB Compounds: (A:) phosphotriesterase

SCOPe Domain Sequences for d3a3wa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3a3wa_ c.1.9.3 (A:) Phosphotriesterase (parathion hydrolase, PTE) {Agrobacterium tumefaciens [TaxId: 358]}
tgdlintvrgpipvseagftlthehicassagflrawpeffgsrkalvekavrglrhara
agvqtivdvstfdigrdvrllaevsqaadvhivaatglwfdpplsmrmrsveeltqfflr
eiqhgiedtgiragiikvattgkatpfqelvlraaaraslatgvpvtthtsasprggeqq
aaifeseglspsrvcighsddtddlsyltglaargylvgldrmpysatglegnasalalf
strswqtrallikalidrgykdrilvshdwlfgfssyvtnimdvmdrinpdgmafvplrv
ipflrekgvppetlagvtvanparflspt

SCOPe Domain Coordinates for d3a3wa_:

Click to download the PDB-style file with coordinates for d3a3wa_.
(The format of our PDB-style files is described here.)

Timeline for d3a3wa_: