SCOPe 2.01: Domain d3a3ua_: 3a3u A:

Lineage for d3a3ua_ (3a3u A:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (41 proteins)

6. Protein Hypothetical protein TTHA1568 [142806] (1 species)
   member of Pfam PF02642 (DUF191)

7. Species Thermus thermophilus [TaxId:274] [142807] (2 PDB entries)
   Uniprot Q5SI12 3-272

8. Domain d3a3ua_: 3a3u A: [171707]
   automated match to d2czla1
   complexed with 7pe, k, tla

Details for d3a3ua_

PDB Entry: 3a3u, 1.65 Å

PDB Description: Crystal structure of MqnD (TTHA1568), a menaquinone biosynthetic enzyme from Thermus thermophilus HB8

PDB Compounds: (A:) Menaquinone biosynthetic enzyme

SCOPe Domain Sequences for d3a3ua_:

Sequence; same for both SEQRES and ATOM records:

>d3a3ua_ c.94.1.1 (A:) Hypothetical protein TTHA1568 {Thermus thermophilus [TaxId: 274]}
alrlgfspcpndtfifyalvhgrvespvplepvledvetlnrwalegrlpltklsyaaya
qvrdryvalrsggalgrgvgplvvargplqaleglrvavpgrhttayfllslyaqgfvpv
evrydrilpmvaqgeveagliihesrftypryglvqvvdlgawweertglplplgailar
rdlgegliraldeavrrsvayalahpeealdymrahaqelsdeviwahvhtyvnafsldv
geegeravarlfaeaearglaapsprplfv

Timeline for d3a3ua_:

• d3a3ua_ is new in SCOPe 2.01-stable
  
• d3a3ua_ appears in SCOPe 2.02
  
• d3a3ua_ appears in the current release, SCOPe 2.08