Lineage for d3a3ua_ (3a3u A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1008597Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 1008598Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 1008599Family c.94.1.1: Phosphate binding protein-like [53851] (41 proteins)
  6. 1009083Protein Hypothetical protein TTHA1568 [142806] (1 species)
    member of Pfam PF02642 (DUF191)
  7. 1009084Species Thermus thermophilus [TaxId:274] [142807] (2 PDB entries)
    Uniprot Q5SI12 3-272
  8. 1009086Domain d3a3ua_: 3a3u A: [171707]
    automated match to d2czla1
    complexed with 7pe, k, tla

Details for d3a3ua_

PDB Entry: 3a3u (more details), 1.65 Å

PDB Description: Crystal structure of MqnD (TTHA1568), a menaquinone biosynthetic enzyme from Thermus thermophilus HB8
PDB Compounds: (A:) Menaquinone biosynthetic enzyme

SCOPe Domain Sequences for d3a3ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3a3ua_ c.94.1.1 (A:) Hypothetical protein TTHA1568 {Thermus thermophilus [TaxId: 274]}
alrlgfspcpndtfifyalvhgrvespvplepvledvetlnrwalegrlpltklsyaaya
qvrdryvalrsggalgrgvgplvvargplqaleglrvavpgrhttayfllslyaqgfvpv
evrydrilpmvaqgeveagliihesrftypryglvqvvdlgawweertglplplgailar
rdlgegliraldeavrrsvayalahpeealdymrahaqelsdeviwahvhtyvnafsldv
geegeravarlfaeaearglaapsprplfv

SCOPe Domain Coordinates for d3a3ua_:

Click to download the PDB-style file with coordinates for d3a3ua_.
(The format of our PDB-style files is described here.)

Timeline for d3a3ua_: