![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication parallel beta-sheet of 6 strands, order 213456 |
![]() | Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) ![]() Similar in architecture to the superfamily II but partly differs in topology |
![]() | Family c.93.1.1: L-arabinose binding protein-like [53823] (18 proteins) |
![]() | Protein Hormone binding domain of the atrial natriuretic peptide receptor [53845] (2 species) |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [53846] (3 PDB entries) Uniprot P18910 29-454 |
![]() | Domain d3a3ka_: 3a3k A: [171705] automated match to d1dp4c_ complexed with br, nag, so4 |
PDB Entry: 3a3k (more details), 2.5 Å
SCOPe Domain Sequences for d3a3ka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3a3ka_ c.93.1.1 (A:) Hormone binding domain of the atrial natriuretic peptide receptor {Norway rat (Rattus norvegicus) [TaxId: 10116]} sdltvavvlpltntsypwswarvgpavelalarvkarpdllpgwtvrmvlgssenaagvc sdtaaplaavdlkwehspavflgpgcvysaapvgrftahwrvplltagapalgigvkdey alttrtgpshvklgdfvtalhrrlgwehqalvlyadrlgddrpcffiveglymrvrerln itvnhqefvegdpdhypkllravrrkgrviyicsspdafrnlmllalnagltgedyvffh ldvfgqslksaqglvpqkpwergdgqdrsarqafqaakiitykepdnpeyleflkqlkll adkkfnftvedglkniipasfhdglllyvqavtetlaqggtvtdgenitqrmwnrsfqgv tgylkidrngdrdtdfslwdmdpetgafrvvlnyngtsqelmavsehklywplgypppdv pkcgf
Timeline for d3a3ka_: