Lineage for d3a3ka_ (3a3k A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2143708Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 2143709Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 2143710Family c.93.1.1: L-arabinose binding protein-like [53823] (18 protein domains)
  6. 2143799Protein Hormone binding domain of the atrial natriuretic peptide receptor [53845] (2 species)
  7. 2143804Species Norway rat (Rattus norvegicus) [TaxId:10116] [53846] (3 PDB entries)
    Uniprot P18910 29-454
  8. 2143807Domain d3a3ka_: 3a3k A: [171705]
    automated match to d1dp4c_
    complexed with br, nag, so4

Details for d3a3ka_

PDB Entry: 3a3k (more details), 2.5 Å

PDB Description: Reversibly bound chloride in the atrial natriuretic peptide receptor hormone-binding domain
PDB Compounds: (A:) Atrial natriuretic peptide receptor A

SCOPe Domain Sequences for d3a3ka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3a3ka_ c.93.1.1 (A:) Hormone binding domain of the atrial natriuretic peptide receptor {Norway rat (Rattus norvegicus) [TaxId: 10116]}
sdltvavvlpltntsypwswarvgpavelalarvkarpdllpgwtvrmvlgssenaagvc
sdtaaplaavdlkwehspavflgpgcvysaapvgrftahwrvplltagapalgigvkdey
alttrtgpshvklgdfvtalhrrlgwehqalvlyadrlgddrpcffiveglymrvrerln
itvnhqefvegdpdhypkllravrrkgrviyicsspdafrnlmllalnagltgedyvffh
ldvfgqslksaqglvpqkpwergdgqdrsarqafqaakiitykepdnpeyleflkqlkll
adkkfnftvedglkniipasfhdglllyvqavtetlaqggtvtdgenitqrmwnrsfqgv
tgylkidrngdrdtdfslwdmdpetgafrvvlnyngtsqelmavsehklywplgypppdv
pkcgf

SCOPe Domain Coordinates for d3a3ka_:

Click to download the PDB-style file with coordinates for d3a3ka_.
(The format of our PDB-style files is described here.)

Timeline for d3a3ka_: