SCOP 1.65: Domain d1b4cb_: 1b4c B:

Lineage for d1b4cb_ (1b4c B:)

1. Root: SCOP 1.65

2. Class a: All alpha proteins [46456] (179 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (10 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.2: S100 proteins [47478] (1 protein)
   dimer: subunits are made of two EF-hands

6. Protein Calcyclin (S100) [47479] (16 species)

7. Species Rat (Rattus norvegicus), s100b [TaxId:10116] [47481] (5 PDB entries)

8. Domain d1b4cb_: 1b4c B: [17170]

Details for d1b4cb_

PDB Entry: 1b4c

PDB Description: solution structure of rat apo-s100b using dipolar couplings

SCOP Domain Sequences for d1b4cb_:

Sequence; same for both SEQRES and ATOM records:

>d1b4cb_ a.39.1.2 (B:) Calcyclin (S100) {Rat (Rattus norvegicus), s100b}
mselekamvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmet
ldedgdgecdfqefmafvsmvttacheffehe

Timeline for d1b4cb_:

• d1b4cb_ first appeared (with stable ids) in SCOP 1.55
  
• d1b4cb_ appears in SCOP 1.63
  
• d1b4cb_ appears in SCOP 1.67
  
• d1b4cb_ appears in the current release, SCOPe 2.08