Lineage for d1b4cb_ (1b4c B:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 3180Fold a.39: EF Hand-like [47472] (3 superfamilies)
  4. 3181Superfamily a.39.1: EF-hand [47473] (7 families) (S)
  5. 3199Family a.39.1.2: S100 proteins [47478] (1 protein)
  6. 3200Protein Calcyclin (S100) [47479] (9 species)
  7. 3234Species Rat (Rattus norvegicus), s100b [TaxId:10116] [47481] (4 PDB entries)
  8. 3242Domain d1b4cb_: 1b4c B: [17170]

Details for d1b4cb_

PDB Entry: 1b4c (more details)

PDB Description: solution structure of rat apo-s100b using dipolar couplings

SCOP Domain Sequences for d1b4cb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b4cb_ a.39.1.2 (B:) Calcyclin (S100) {Rat (Rattus norvegicus), s100b}
mselekamvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmet
ldedgdgecdfqefmafvsmvttacheffehe

SCOP Domain Coordinates for d1b4cb_:

Click to download the PDB-style file with coordinates for d1b4cb_.
(The format of our PDB-style files is described here.)

Timeline for d1b4cb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1b4ca_