![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
![]() | Superfamily a.39.1: EF-hand [47473] (12 families) ![]() Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
![]() | Family a.39.1.2: S100 proteins [47478] (2 proteins) dimer: subunits are made of two EF-hands |
![]() | Protein Calcyclin (S100) [47479] (17 species) |
![]() | Species Norway rat (Rattus norvegicus), s100b [TaxId:10116] [47481] (7 PDB entries) |
![]() | Domain d1b4cb_: 1b4c B: [17170] |
PDB Entry: 1b4c (more details)
SCOPe Domain Sequences for d1b4cb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b4cb_ a.39.1.2 (B:) Calcyclin (S100) {Norway rat (Rattus norvegicus), s100b [TaxId: 10116]} mselekamvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmet ldedgdgecdfqefmafvsmvttacheffehe
Timeline for d1b4cb_: