SCOPe 2.07: Domain d3a33a1: 3a33 A:1-147

Lineage for d3a33a1 (3a33 A:1-147)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2

4. Superfamily d.20.1: UBC-like [54495] (5 families)

5. Family d.20.1.1: UBC-related [54496] (7 proteins)

6. Protein automated matches [190124] (13 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186848] (60 PDB entries)

8. Domain d3a33a1: 3a33 A:1-147 [171693]
   Other proteins in same PDB: d3a33a2, d3a33b_
   automated match to d1ur6a_
   complexed with gol

Details for d3a33a1

PDB Entry: 3a33, 2.2 Å

PDB Description: UbcH5b~Ubiquitin Conjugate

PDB Compounds: (A:) ubiquitin-conjugating enzyme e2 d2

SCOPe Domain Sequences for d3a33a1:

Sequence; same for both SEQRES and ATOM records:

>d3a33a1 d.20.1.1 (A:1-147) automated matches {Human (Homo sapiens) [TaxId: 9606]}
malkrihkelndlardppaqcsagpvgddmfhwqatimgpndspyqggvffltihfptdy
pfkppkvafttriyhpninsngsisldilrsqwspaltiskvllsicsllcdpnpddplv
peiariyktdrekynriarewtqkyam

Timeline for d3a33a1:

• d3a33a1 first appeared in SCOPe 2.01, called d3a33a_
  
• d3a33a1 appears in SCOPe 2.06
  
• d3a33a1 appears in the current release, SCOPe 2.08