Lineage for d1b4ca_ (1b4c A:)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 152429Fold a.39: EF Hand-like [47472] (4 superfamilies)
  4. 152430Superfamily a.39.1: EF-hand [47473] (8 families) (S)
  5. 152453Family a.39.1.2: S100 proteins [47478] (1 protein)
  6. 152454Protein Calcyclin (S100) [47479] (13 species)
  7. 152523Species Rat (Rattus norvegicus), s100b [TaxId:10116] [47481] (4 PDB entries)
  8. 152528Domain d1b4ca_: 1b4c A: [17169]

Details for d1b4ca_

PDB Entry: 1b4c (more details)

PDB Description: solution structure of rat apo-s100b using dipolar couplings

SCOP Domain Sequences for d1b4ca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b4ca_ a.39.1.2 (A:) Calcyclin (S100) {Rat (Rattus norvegicus), s100b}
mselekamvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmet
ldedgdgecdfqefmafvsmvttacheffehe

SCOP Domain Coordinates for d1b4ca_:

Click to download the PDB-style file with coordinates for d1b4ca_.
(The format of our PDB-style files is described here.)

Timeline for d1b4ca_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1b4cb_