SCOP 1.61: Domain d1b4ca_: 1b4c A:

Lineage for d1b4ca_ (1b4c A:)

1. Root: SCOP 1.61

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)

4. Superfamily a.39.1: EF-hand [47473] (8 families)

5. Family a.39.1.2: S100 proteins [47478] (1 protein)

6. Protein Calcyclin (S100) [47479] (13 species)

7. Species Rat (Rattus norvegicus), s100b [TaxId:10116] [47481] (4 PDB entries)

8. Domain d1b4ca_: 1b4c A: [17169]

Details for d1b4ca_

PDB Entry: 1b4c

PDB Description: solution structure of rat apo-s100b using dipolar couplings

SCOP Domain Sequences for d1b4ca_:

Sequence; same for both SEQRES and ATOM records:

>d1b4ca_ a.39.1.2 (A:) Calcyclin (S100) {Rat (Rattus norvegicus), s100b}
mselekamvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmet
ldedgdgecdfqefmafvsmvttacheffehe

Timeline for d1b4ca_:

• d1b4ca_ first appeared (with stable ids) in SCOP 1.55
  
• d1b4ca_ appears in SCOP 1.59
  
• d1b4ca_ appears in SCOP 1.63
  
• d1b4ca_ appears in the current release, SCOPe 2.08