Lineage for d1symb_ (1sym B:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 47511Fold a.39: EF Hand-like [47472] (3 superfamilies)
  4. 47512Superfamily a.39.1: EF-hand [47473] (8 families) (S)
  5. 47532Family a.39.1.2: S100 proteins [47478] (1 protein)
  6. 47533Protein Calcyclin (S100) [47479] (9 species)
  7. 47567Species Rat (Rattus norvegicus), s100b [TaxId:10116] [47481] (4 PDB entries)
  8. 47573Domain d1symb_: 1sym B: [17168]

Details for d1symb_

PDB Entry: 1sym (more details)

PDB Description: 3-d solution structure of reduced apo-s100b from rat, nmr, 20 structures

SCOP Domain Sequences for d1symb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1symb_ a.39.1.2 (B:) Calcyclin (S100) {Rat (Rattus norvegicus), s100b}
mselekamvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmet
ldedgdgecdfqefmafvsmvttacheffehe

SCOP Domain Coordinates for d1symb_:

Click to download the PDB-style file with coordinates for d1symb_.
(The format of our PDB-style files is described here.)

Timeline for d1symb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1syma_