SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3a2wa_ (3a2w A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2116932Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2116933Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2118053Family c.47.1.10: Glutathione peroxidase-like [52901] (29 protein domains)
  6. 2118396Protein automated matches [190100] (19 species)
    not a true protein
  7. 2118405Species Aeropyrum pernix [TaxId:272557] [186846] (8 PDB entries)
  8. 2118465Domain d3a2wa_: 3a2w A: [171673]
    automated match to d1x0ra1
    complexed with gol, per

Details for d3a2wa_

PDB Entry: 3a2w (more details), 2.3 Å

PDB Description: Peroxiredoxin (C50S) from Aeropytum pernix K1 (peroxide-bound form)
PDB Compounds: (A:) Probable peroxiredoxin

SCOPe Domain Sequences for d3a2wa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3a2wa_ c.47.1.10 (A:) automated matches {Aeropyrum pernix [TaxId: 272557]}
pgsipligerfpemevttdhgviklpdhyvsqgkwfvlfshpadftpvsttefvsfarry
edfqrlgvdliglsvdsvfshikwkewierhigvripfpiiadpqgtvarrlgllhaesa
thtvrgvfivdargvirtmlyypmelgrlvdeilrivkalklgdslkravpadwpnneii
geglivpppttedqararmesgqyrcldwwfcwdtpasrddveearrylrraaekpakll
yeea

SCOPe Domain Coordinates for d3a2wa_:

Click to download the PDB-style file with coordinates for d3a2wa_.
(The format of our PDB-style files is described here.)

Timeline for d3a2wa_: