SCOPe 2.04: Domain d1syma_: 1sym A:

Lineage for d1syma_ (1sym A:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.2: S100 proteins [47478] (2 proteins)
   dimer: subunits are made of two EF-hands

6. Protein Calcyclin (S100) [47479] (17 species)

7. Species Norway rat (Rattus norvegicus), s100b [TaxId:10116] [47481] (7 PDB entries)

8. Domain d1syma_: 1sym A: [17167]

Details for d1syma_

PDB Entry: 1sym

PDB Description: 3-d solution structure of reduced apo-s100b from rat, nmr, 20 structures

PDB Compounds: (A:) s100b

SCOPe Domain Sequences for d1syma_:

Sequence; same for both SEQRES and ATOM records:

>d1syma_ a.39.1.2 (A:) Calcyclin (S100) {Norway rat (Rattus norvegicus), s100b [TaxId: 10116]}
mselekamvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmet
ldedgdgecdfqefmafvsmvttacheffehe

Timeline for d1syma_:

• d1syma_ first appeared (with stable ids) in SCOP 1.55
  
• d1syma_ appears in SCOPe 2.03
  
• d1syma_ appears in SCOPe 2.05
  
• d1syma_ appears in the current release, SCOPe 2.08