Lineage for d1syma_ (1sym A:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 355182Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 355183Superfamily a.39.1: EF-hand [47473] (10 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 355207Family a.39.1.2: S100 proteins [47478] (1 protein)
    dimer: subunits are made of two EF-hands
  6. 355208Protein Calcyclin (S100) [47479] (16 species)
  7. 355297Species Rat (Rattus norvegicus), s100b [TaxId:10116] [47481] (5 PDB entries)
  8. 355306Domain d1syma_: 1sym A: [17167]

Details for d1syma_

PDB Entry: 1sym (more details)

PDB Description: 3-d solution structure of reduced apo-s100b from rat, nmr, 20 structures

SCOP Domain Sequences for d1syma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1syma_ a.39.1.2 (A:) Calcyclin (S100) {Rat (Rattus norvegicus), s100b}
mselekamvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmet
ldedgdgecdfqefmafvsmvttacheffehe

SCOP Domain Coordinates for d1syma_:

Click to download the PDB-style file with coordinates for d1syma_.
(The format of our PDB-style files is described here.)

Timeline for d1syma_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1symb_