Lineage for d3a2vg_ (3a2v G:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2877441Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)
  6. 2877880Protein automated matches [190100] (21 species)
    not a true protein
  7. 2877891Species Aeropyrum pernix [TaxId:272557] [186846] (19 PDB entries)
  8. 2877898Domain d3a2vg_: 3a2v G: [171669]
    automated match to d1x0ra1
    complexed with per

Details for d3a2vg_

PDB Entry: 3a2v (more details), 1.65 Å

PDB Description: peroxiredoxin (c207s) from aeropyrum pernix k1 complexed with hydrogen peroxide
PDB Compounds: (G:) Probable peroxiredoxin

SCOPe Domain Sequences for d3a2vg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3a2vg_ c.47.1.10 (G:) automated matches {Aeropyrum pernix [TaxId: 272557]}
pgsipligerfpemevttdhgviklpdhyvsqgkwfvlfshpadftpvcttefvsfarry
edfqrlgvdliglsvdsvfshikwkewierhigvripfpiiadpqgtvarrlgllhaesa
thtvrgvfivdargvirtmlyypmelgrlvdeilrivkalklgdslkravpadwpnneii
geglivpppttedqararmesgqyrsldwwfcwdtpasrddveearrylrraaekpakll
yee

SCOPe Domain Coordinates for d3a2vg_:

Click to download the PDB-style file with coordinates for d3a2vg_.
(The format of our PDB-style files is described here.)

Timeline for d3a2vg_: