Class a: All alpha proteins [46456] (284 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
Family a.39.1.2: S100 proteins [47478] (2 proteins) dimer: subunits are made of two EF-hands |
Protein Calcyclin (S100) [47479] (17 species) |
Species Rat (Rattus norvegicus), s100b [TaxId:10116] [47481] (6 PDB entries) |
Domain d1dt7b_: 1dt7 B: [17166] Other proteins in same PDB: d1dt7x_, d1dt7y_ complex with the C-terminal negative regulatory domain of p53 complexed with ca |
PDB Entry: 1dt7 (more details)
SCOPe Domain Sequences for d1dt7b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dt7b_ a.39.1.2 (B:) Calcyclin (S100) {Rat (Rattus norvegicus), s100b [TaxId: 10116]} mselekamvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmet ldedgdgecdfqefmafvsmvttacheffehe
Timeline for d1dt7b_: