Lineage for d1dt7b_ (1dt7 B:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 47511Fold a.39: EF Hand-like [47472] (3 superfamilies)
  4. 47512Superfamily a.39.1: EF-hand [47473] (8 families) (S)
  5. 47532Family a.39.1.2: S100 proteins [47478] (1 protein)
  6. 47533Protein Calcyclin (S100) [47479] (9 species)
  7. 47567Species Rat (Rattus norvegicus), s100b [TaxId:10116] [47481] (4 PDB entries)
  8. 47571Domain d1dt7b_: 1dt7 B: [17166]
    Other proteins in same PDB: d1dt7x_, d1dt7y_

Details for d1dt7b_

PDB Entry: 1dt7 (more details)

PDB Description: solution structure of the c-terminal negative regulatory domain of p53 in a complex with ca2+-bound s100b(bb)

SCOP Domain Sequences for d1dt7b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dt7b_ a.39.1.2 (B:) Calcyclin (S100) {Rat (Rattus norvegicus), s100b}
mselekamvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmet
ldedgdgecdfqefmafvsmvttacheffehe

SCOP Domain Coordinates for d1dt7b_:

Click to download the PDB-style file with coordinates for d1dt7b_.
(The format of our PDB-style files is described here.)

Timeline for d1dt7b_: