Lineage for d3a2ha_ (3a2h A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2728284Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2728285Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2728286Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2729577Protein Vitamin D nuclear receptor [48528] (2 species)
  7. 2729609Species Norway rat (Rattus norvegicus) [TaxId:10116] [101432] (25 PDB entries)
  8. 2729631Domain d3a2ha_: 3a2h A: [171659]
    automated match to d1rkha_
    protein/DNA complex; complexed with tej

Details for d3a2ha_

PDB Entry: 3a2h (more details), 2.5 Å

PDB Description: crystal structure of the rat vitamin d receptor ligand binding domain complexed with tei-9647 and a synthetic peptide containing the nr2 box of drip 205
PDB Compounds: (A:) Vitamin D3 receptor

SCOPe Domain Sequences for d3a2ha_:

Sequence, based on SEQRES records: (download)

>d3a2ha_ a.123.1.1 (A:) Vitamin D nuclear receptor {Norway rat (Rattus norvegicus) [TaxId: 10116]}
klseeqqhiiailldahhktydptyadfrdfrppvrmdgstgsvtldlsplsmlphladl
vsysiqkvigfakmipgfrdltsddqivllkssaievimlrsnqsftmddmswdcgsqdy
kydvtdvskaghtlelieplikfqvglkklnlheeehvllmaicivspdrpgvqdaklve
aiqdrlsntlqtyircrhpppgshqlyakmiqkladlrslneehskqyrslsfqpensmk
ltplvlevfgne

Sequence, based on observed residues (ATOM records): (download)

>d3a2ha_ a.123.1.1 (A:) Vitamin D nuclear receptor {Norway rat (Rattus norvegicus) [TaxId: 10116]}
klseeqqhiiailldahhktydptyadfrdfrppvrplsmlphladlvsysiqkvigfak
mipgfrdltsddqivllkssaievimlrsnqsftmddmswdcgsqdykydvtdvskaght
lelieplikfqvglkklnlheeehvllmaicivspdrpgvqdaklveaiqdrlsntlqty
ircrhpppgshqlyakmiqkladlrslneehskqyrslsfqpensmkltplvlevfgne

SCOPe Domain Coordinates for d3a2ha_:

Click to download the PDB-style file with coordinates for d3a2ha_.
(The format of our PDB-style files is described here.)

Timeline for d3a2ha_: