SCOPe 2.04: Domain d1dt7a_: 1dt7 A:

Lineage for d1dt7a_ (1dt7 A:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.2: S100 proteins [47478] (2 proteins)
   dimer: subunits are made of two EF-hands

6. Protein Calcyclin (S100) [47479] (17 species)

7. Species Norway rat (Rattus norvegicus), s100b [TaxId:10116] [47481] (7 PDB entries)

8. Domain d1dt7a_: 1dt7 A: [17165]
   Other proteins in same PDB: d1dt7x_, d1dt7y_
   complex with the C-terminal negative regulatory domain of p53
   complexed with ca

Details for d1dt7a_

PDB Entry: 1dt7

PDB Description: solution structure of the c-terminal negative regulatory domain of p53 in a complex with ca2+-bound s100b(bb)

PDB Compounds: (A:) s100 calcium-binding protein

SCOPe Domain Sequences for d1dt7a_:

Sequence; same for both SEQRES and ATOM records:

>d1dt7a_ a.39.1.2 (A:) Calcyclin (S100) {Norway rat (Rattus norvegicus), s100b [TaxId: 10116]}
mselekamvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmet
ldedgdgecdfqefmafvsmvttacheffehe

Timeline for d1dt7a_:

• d1dt7a_ first appeared (with stable ids) in SCOP 1.55
  
• d1dt7a_ appears in SCOPe 2.03
  
• d1dt7a_ appears in SCOPe 2.05
  
• d1dt7a_ appears in the current release, SCOPe 2.08