SCOP 1.59: Domain d1dt7a_: 1dt7 A:

Lineage for d1dt7a_ (1dt7 A:)

1. Root: SCOP 1.59

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)

4. Superfamily a.39.1: EF-hand [47473] (8 families)

5. Family a.39.1.2: S100 proteins [47478] (1 protein)

6. Protein Calcyclin (S100) [47479] (11 species)

7. Species Rat (Rattus norvegicus), s100b [TaxId:10116] [47481] (4 PDB entries)

8. Domain d1dt7a_: 1dt7 A: [17165]
   Other proteins in same PDB: d1dt7x_, d1dt7y_

Details for d1dt7a_

PDB Entry: 1dt7

PDB Description: solution structure of the c-terminal negative regulatory domain of p53 in a complex with ca2+-bound s100b(bb)

SCOP Domain Sequences for d1dt7a_:

Sequence; same for both SEQRES and ATOM records:

>d1dt7a_ a.39.1.2 (A:) Calcyclin (S100) {Rat (Rattus norvegicus), s100b}
mselekamvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmet
ldedgdgecdfqefmafvsmvttacheffehe

Timeline for d1dt7a_:

• d1dt7a_ first appeared (with stable ids) in SCOP 1.55
  
• d1dt7a_ appears in SCOP 1.57
  
• d1dt7a_ appears in SCOP 1.61
  
• d1dt7a_ appears in the current release, SCOPe 2.08