Lineage for d3a28c_ (3a28 C:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 975118Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 975119Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 978249Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 978250Protein automated matches [190069] (51 species)
    not a true protein
  7. 978297Species Brevibacterium saccharolyticum [TaxId:1718] [189138] (1 PDB entry)
  8. 978300Domain d3a28c_: 3a28 C: [171649]
    automated match to d1gege_
    complexed with bme, mg, nad

Details for d3a28c_

PDB Entry: 3a28 (more details), 2 Å

PDB Description: Crystal structure of L-2,3-butanediol dehydrogenase
PDB Compounds: (C:) L-2.3-butanediol dehydrogenase

SCOPe Domain Sequences for d3a28c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3a28c_ c.2.1.0 (C:) automated matches {Brevibacterium saccharolyticum [TaxId: 1718]}
skvamvtggaqgigrgiseklaadgfdiavadlpqqeeqaaetiklieaadqkavfvgld
vtdkanfdsaideaaeklggfdvlvnnagiaqikpllevteedlkqiysvnvfsvffgiq
aasrkfdelgvkgkiinaasiaaiqgfpilsaysttkfavrgltqaaaqelapkghtvna
yapgivgtgmweqidaelskingkpigenfkeysssialgrpsvpedvaglvsflasens
nyvtgqvmlvdggmlyn

SCOPe Domain Coordinates for d3a28c_:

Click to download the PDB-style file with coordinates for d3a28c_.
(The format of our PDB-style files is described here.)

Timeline for d3a28c_: