SCOPe 2.05: Domain d3a0kg_: 3a0k G:

Lineage for d3a0kg_ (3a0k G:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.1: Legume lectins [49900] (5 proteins)

6. Protein automated matches [190035] (21 species)
   not a true protein

7. Species Cymbosema roseum [TaxId:202239] [189292] (2 PDB entries)

8. Domain d3a0kg_: 3a0k G: [171637]
   automated match to d1h9wa_
   complexed with aba, ca, mn

Details for d3a0kg_

PDB Entry: 3a0k, 1.8 Å

PDB Description: crystal structure of an antiflamatory legume lectin from cymbosema roseum seeds

PDB Compounds: (G:) Cymbosema roseum mannose-specific lectin

SCOPe Domain Sequences for d3a0kg_:

Sequence; same for both SEQRES and ATOM records:

>d3a0kg_ b.29.1.1 (G:) automated matches {Cymbosema roseum [TaxId: 202239]}
adtivaveldsypntdigdpsyphigidiksirskstarwnmqtgkvgtahisynsvakr
ltavvsysgsssttvsydvdltnvlpewvrvglsattglyketntilswsftsklktnsi
adanalhfsfnqftqnpkdlilqgdattdsdgnleltkvsssgspqgssvgralfyapvh
iwessavvasfdatftflikspdsepadgitffiantdtsipsgssgrllglfpdan

Timeline for d3a0kg_:

• d3a0kg_ first appeared in SCOPe 2.01
  
• d3a0kg_ appears in SCOPe 2.04
  
• d3a0kg_ appears in SCOPe 2.06
  
• d3a0kg_ appears in the current release, SCOPe 2.08