![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
![]() | Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
![]() | Family b.29.1.1: Legume lectins [49900] (5 proteins) |
![]() | Protein automated matches [190035] (28 species) not a true protein |
![]() | Species Cymbosema roseum [TaxId:202239] [189292] (2 PDB entries) |
![]() | Domain d3a0ke_: 3a0k E: [171636] automated match to d1h9wa_ complexed with aba, ca, mn |
PDB Entry: 3a0k (more details), 1.8 Å
SCOPe Domain Sequences for d3a0ke_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3a0ke_ b.29.1.1 (E:) automated matches {Cymbosema roseum [TaxId: 202239]} adtivaveldsypntdigdpsyphigidiksirskstarwnmqtgkvgtahisynsvakr ltavvsysgsssttvsydvdltnvlpewvrvglsattglyketntilswsftsklktnsi adanalhfsfnqftqnpkdlilqgdattdsdgnleltkvsssgspqgssvgralfyapvh iwessavvasfdatftflikspdsepadgitffiantdtsipsgssgrllglfpdan
Timeline for d3a0ke_: