Class b: All beta proteins [48724] (174 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) |
Family b.29.1.1: Legume lectins [49900] (5 proteins) |
Protein automated matches [190035] (15 species) not a true protein |
Species Cymbosema roseum [TaxId:202239] [189292] (1 PDB entry) |
Domain d3a0kc_: 3a0k C: [171635] automated match to d1h9wa_ complexed with aba, ca, mn |
PDB Entry: 3a0k (more details), 1.8 Å
SCOPe Domain Sequences for d3a0kc_:
Sequence, based on SEQRES records: (download)
>d3a0kc_ b.29.1.1 (C:) automated matches {Cymbosema roseum [TaxId: 202239]} adtivaveldsypntdigdpsyphigidiksirskstarwnmqtgkvgtahisynsvakr ltavvsysgsssttvsydvdltnvlpewvrvglsattglyketntilswsftsklktnsi adanalhfsfnqftqnpkdlilqgdattdsdgnleltkvsssgspqgssvgralfyapvh iwessavvasfdatftflikspdsepadgitffiantdtsipsgssgrllglfpdan
>d3a0kc_ b.29.1.1 (C:) automated matches {Cymbosema roseum [TaxId: 202239]} adtivaveldsypntdigdpsyphigidiksirskstarwnmqtgkvgtahisynsvakr ltavvsysgsssttvsydvdltnvlpewvrvglsattglyketntilswsftsklktana lhfsfnqftqnpkdlilqgdattdsdgnleltkvsssgspqgssvgralfyapvhiwess avvasfdatftflikspdsepadgitffiantdtsipsgssgrllglfpdan
Timeline for d3a0kc_: