Lineage for d3a0kc_ (3a0k C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2778276Family b.29.1.1: Legume lectins [49900] (5 proteins)
  6. 2778888Protein automated matches [190035] (28 species)
    not a true protein
  7. 2779017Species Cymbosema roseum [TaxId:202239] [189292] (2 PDB entries)
  8. 2779020Domain d3a0kc_: 3a0k C: [171635]
    automated match to d1h9wa_
    complexed with aba, ca, mn

Details for d3a0kc_

PDB Entry: 3a0k (more details), 1.8 Å

PDB Description: crystal structure of an antiflamatory legume lectin from cymbosema roseum seeds
PDB Compounds: (C:) Cymbosema roseum mannose-specific lectin

SCOPe Domain Sequences for d3a0kc_:

Sequence, based on SEQRES records: (download)

>d3a0kc_ b.29.1.1 (C:) automated matches {Cymbosema roseum [TaxId: 202239]}
adtivaveldsypntdigdpsyphigidiksirskstarwnmqtgkvgtahisynsvakr
ltavvsysgsssttvsydvdltnvlpewvrvglsattglyketntilswsftsklktnsi
adanalhfsfnqftqnpkdlilqgdattdsdgnleltkvsssgspqgssvgralfyapvh
iwessavvasfdatftflikspdsepadgitffiantdtsipsgssgrllglfpdan

Sequence, based on observed residues (ATOM records): (download)

>d3a0kc_ b.29.1.1 (C:) automated matches {Cymbosema roseum [TaxId: 202239]}
adtivaveldsypntdigdpsyphigidiksirskstarwnmqtgkvgtahisynsvakr
ltavvsysgsssttvsydvdltnvlpewvrvglsattglyketntilswsftsklktana
lhfsfnqftqnpkdlilqgdattdsdgnleltkvsssgspqgssvgralfyapvhiwess
avvasfdatftflikspdsepadgitffiantdtsipsgssgrllglfpdan

SCOPe Domain Coordinates for d3a0kc_:

Click to download the PDB-style file with coordinates for d3a0kc_.
(The format of our PDB-style files is described here.)

Timeline for d3a0kc_: