SCOPe 2.01: Domain d3a0jb_: 3a0j B:

Lineage for d3a0jb_ (3a0j B:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families)

5. Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (31 proteins)
   barrel, closed; n=5, S=8

6. Protein automated matches [190915] (4 species)
   not a true protein

7. Species Thermus thermophilus [TaxId:300852] [189282] (1 PDB entry)

8. Domain d3a0jb_: 3a0j B: [171633]
   automated match to d1hzaa_

Details for d3a0jb_

PDB Entry: 3a0j, 1.65 Å

PDB Description: Crystal structure of cold shock protein 1 from Thermus thermophilus HB8

PDB Compounds: (B:) Cold shock protein

SCOPe Domain Sequences for d3a0jb_:

Sequence; same for both SEQRES and ATOM records:

>d3a0jb_ b.40.4.5 (B:) automated matches {Thermus thermophilus [TaxId: 300852]}
mqkgrvkwfnaekgygfieregdtdvfvhytainakgfrtlnegdivtfdvepgrngkgp
qavnvtvveparr

Timeline for d3a0jb_:

• d3a0jb_ is new in SCOPe 2.01-stable
  
• d3a0jb_ appears in SCOPe 2.02
  
• d3a0jb_ appears in the current release, SCOPe 2.08