| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
| Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
| Protein automated matches [190359] (43 species) not a true protein |
| Species Guinea pig (Cavia porcellus) [TaxId:10141] [189281] (2 PDB entries) |
| Domain d3a0gb_: 3a0g B: [171631] automated match to d1fhjb_ complexed with hem, oxy |
PDB Entry: 3a0g (more details), 2.5 Å
SCOPe Domain Sequences for d3a0gb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3a0gb_ a.1.1.2 (B:) automated matches {Guinea pig (Cavia porcellus) [TaxId: 10141]}
vhltaaeksaildlwgkvnvgeigaealgrllvvypwtqrffekfgdlssasaimsnahv
kshgakvlasfseglkhlqdlkgtfaklselhcdklhvdpenfrllgnmltiaiahhhps
eftpctqaafqkvtagvanalahk
Timeline for d3a0gb_: