Lineage for d3a0ga_ (3a0g A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2688401Protein automated matches [190359] (43 species)
    not a true protein
  7. 2688678Species Guinea pig (Cavia porcellus) [TaxId:10141] [189281] (2 PDB entries)
  8. 2688681Domain d3a0ga_: 3a0g A: [171630]
    automated match to d1bz1a_
    complexed with hem, oxy

Details for d3a0ga_

PDB Entry: 3a0g (more details), 2.5 Å

PDB Description: crystal structure analysis of guinea pig oxyhemoglobin at 2.5 angstroms resolution
PDB Compounds: (A:) Hemoglobin subunit alpha

SCOPe Domain Sequences for d3a0ga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3a0ga_ a.1.1.2 (A:) automated matches {Guinea pig (Cavia porcellus) [TaxId: 10141]}
vlsaadknnvkttwdkigghaaeyvaegltrmftsfpttktyfhhidvspgsgdikahgk
kvadalttavghlddlptalstlsdvhahklrvdpvnfkflnhcllvtlaahlgadftps
ihasldkffasvstvltsk

SCOPe Domain Coordinates for d3a0ga_:

Click to download the PDB-style file with coordinates for d3a0ga_.
(The format of our PDB-style files is described here.)

Timeline for d3a0ga_: