Lineage for d1qlka_ (1qlk A:)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 152429Fold a.39: EF Hand-like [47472] (4 superfamilies)
  4. 152430Superfamily a.39.1: EF-hand [47473] (8 families) (S)
  5. 152453Family a.39.1.2: S100 proteins [47478] (1 protein)
  6. 152454Protein Calcyclin (S100) [47479] (13 species)
  7. 152523Species Rat (Rattus norvegicus), s100b [TaxId:10116] [47481] (4 PDB entries)
  8. 152524Domain d1qlka_: 1qlk A: [17163]

Details for d1qlka_

PDB Entry: 1qlk (more details)

PDB Description: solution structure of ca(2+)-loaded rat s100b (betabeta) nmr, 20 structures

SCOP Domain Sequences for d1qlka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qlka_ a.39.1.2 (A:) Calcyclin (S100) {Rat (Rattus norvegicus), s100b}
mselekamvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmet
ldedgdgecdfqefmafvsmvttacheffehe

SCOP Domain Coordinates for d1qlka_:

Click to download the PDB-style file with coordinates for d1qlka_.
(The format of our PDB-style files is described here.)

Timeline for d1qlka_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1qlkb_