Lineage for d1qlka_ (1qlk A:)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) Fold a.39: EF Hand-like [47472] (3 superfamilies) Superfamily a.39.1: EF-hand [47473] (7 families) 
Family a.39.1.2: S100 proteins [47478] (1 protein) Protein Calcyclin (S100) [47479] (9 species) 
Species Rat (Rattus norvegicus), s100b [TaxId:10116] [47481] (4 PDB entries) 
Domain d1qlka_: 1qlk A: [17163]
Details for d1qlka_
PDB Entry: 1qlk (more details)
PDB Description: solution structure of ca(2+)-loaded rat s100b (betabeta) nmr, 20 structures
SCOP Domain Sequences for d1qlka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qlka_ a.39.1.2 (A:) Calcyclin (S100) {Rat (Rattus norvegicus), s100b}
mselekamvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmet
ldedgdgecdfqefmafvsmvttacheffehe
SCOP Domain Coordinates for d1qlka_:
Click to download the PDB-style file with coordinates for d1qlka_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1qlka_:
- d1qlka_ appears in SCOP 1.57
- d1qlka_ appears in the current release, SCOPe 2.08
View in 3D
