SCOPe 2.06: Domain d3a0ca_: 3a0c A:

Lineage for d3a0ca_ (3a0c A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.78: beta-Prism II [51109] (1 superfamily)
   consists of 3 4-stranded sheets; strands are perpendicular to the 3-fold axis
   duplication: consists of two domains of this fold

4. Superfamily b.78.1: alpha-D-mannose-specific plant lectins [51110] (2 families)

5. Family b.78.1.0: automated matches [191418] (1 protein)
   not a true family

6. Protein automated matches [190587] (7 species)
   not a true protein

7. Species Polygonatum cyrtonema [TaxId:195526] [189271] (3 PDB entries)

8. Domain d3a0ca_: 3a0c A: [171624]
   automated match to d1jpca_

Details for d3a0ca_

PDB Entry: 3a0c, 2 Å

PDB Description: Crystal Structure of an anti-HIV mannose-binding lectin from Polygonatum cyrtonema Hua

PDB Compounds: (A:) Mannose/sialic acid-binding lectin

SCOPe Domain Sequences for d3a0ca_:

Sequence; same for both SEQRES and ATOM records:

>d3a0ca_ b.78.1.0 (A:) automated matches {Polygonatum cyrtonema [TaxId: 195526]}
vnslsspnslftghslevgpsyrlimqgdcnfvlydsgkpvwasntgglgsgcrltlhnn
gnlviydqsnrviwqtktngkedhyvlvlqqdrnvviygpvvwatgsgp

Timeline for d3a0ca_:

• d3a0ca_ first appeared in SCOPe 2.01
  
• d3a0ca_ appears in SCOPe 2.05
  
• d3a0ca_ appears in SCOPe 2.07
  
• d3a0ca_ appears in the current release, SCOPe 2.08