Lineage for d3a04a_ (3a04 A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1841351Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 1841352Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 1841999Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 1842000Protein automated matches [190459] (41 species)
    not a true protein
  7. 1842001Species Aeropyrum pernix [TaxId:56636] [189259] (3 PDB entries)
  8. 1842002Domain d3a04a_: 3a04 A: [171622]
    automated match to d1ulhb_
    complexed with cd, sf4

Details for d3a04a_

PDB Entry: 3a04 (more details), 1.97 Å

PDB Description: Crystal structure of tryptophanyl-tRNA synthetase from hyperthermophilic archaeon, Aeropyrum pernix K1
PDB Compounds: (A:) Tryptophanyl-tRNA synthetase

SCOPe Domain Sequences for d3a04a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3a04a_ c.26.1.0 (A:) automated matches {Aeropyrum pernix [TaxId: 56636]}
ldpwgaveikdydrllrtfgirpfsevlpllrkagmepsflmrrgiifghrdfdkileak
argervavltgfmpsgkfhfghkltvdqliylqkngfkvfvaiadaeafavrrigreeav
riaveeyianmialgldpkdtefyfqtnrgtpyfrliqlfsgkvtaaemeaiygeltpak
mmasltqaadilhvqldeyggyrhvvvpvgadqdphlrltrdladrmagvvelerpasty
hklqpgldgrkmsssrpdstifltdppevarnklfraltggrataeeqrrlggvpevcsv
yhmdlyhlmpddgevkhiytscrlgkilcgeckqiaweklerflaehqsrlekaktiawk
lvepprf

SCOPe Domain Coordinates for d3a04a_:

Click to download the PDB-style file with coordinates for d3a04a_.
(The format of our PDB-style files is described here.)

Timeline for d3a04a_: