Lineage for d3a03a_ (3a03 A:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1257871Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1257872Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 1258653Family a.4.1.0: automated matches [191447] (1 protein)
    not a true family
  6. 1258654Protein automated matches [190674] (11 species)
    not a true protein
  7. 1258668Species Human (Homo sapiens) [TaxId:9606] [189258] (1 PDB entry)
  8. 1258669Domain d3a03a_: 3a03 A: [171621]
    automated match to d2e1oa1
    complexed with na, so4

Details for d3a03a_

PDB Entry: 3a03 (more details), 1.54 Å

PDB Description: Crystal structure of Hox11L1 homeodomain
PDB Compounds: (A:) T-cell leukemia homeobox protein 2

SCOPe Domain Sequences for d3a03a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3a03a_ a.4.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fsrsqvlelerrflrqkylasaeraalakalrmtdaqvktwfqnrrtkwrrqt

SCOPe Domain Coordinates for d3a03a_:

Click to download the PDB-style file with coordinates for d3a03a_.
(The format of our PDB-style files is described here.)

Timeline for d3a03a_: