![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
![]() | Superfamily a.39.1: EF-hand [47473] (12 families) ![]() Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
![]() | Family a.39.1.2: S100 proteins [47478] (2 proteins) dimer: subunits are made of two EF-hands |
![]() | Protein Calcyclin (S100) [47479] (17 species) |
![]() | Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [47480] (5 PDB entries) |
![]() | Domain d1cnpb_: 1cnp B: [17162] |
PDB Entry: 1cnp (more details)
SCOPe Domain Sequences for d1cnpb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cnpb_ a.39.1.2 (B:) Calcyclin (S100) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} maspldqaiglligifhkysgkegdkhtlskkelkeliqkeltigsklqdaeivklmddl drnkdqevnfqeyitflgalamiynealkg
Timeline for d1cnpb_: