Lineage for d3a01f_ (3a01 F:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 905281Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 905282Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 905283Family a.4.1.1: Homeodomain [46690] (41 proteins)
    Pfam PF00046
  6. 905472Protein automated matches [190360] (2 species)
    not a true protein
  7. 905473Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [187191] (5 PDB entries)
  8. 905477Domain d3a01f_: 3a01 F: [171619]
    automated match to d1fjla_
    protein/DNA complex

Details for d3a01f_

PDB Entry: 3a01 (more details), 2.7 Å

PDB Description: Crystal structure of Aristaless and Clawless homeodomains bound to DNA
PDB Compounds: (F:) Homeobox protein aristaless

SCOPe Domain Sequences for d3a01f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3a01f_ a.4.1.1 (F:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
rryrttftsfqleelekafsrthypdvftreelamkiglteariqvwfqnrrakwrkqek
v

SCOPe Domain Coordinates for d3a01f_:

Click to download the PDB-style file with coordinates for d3a01f_.
(The format of our PDB-style files is described here.)

Timeline for d3a01f_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3a01b_