| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (21 families) ![]() consists only of helices |
| Family a.4.1.1: Homeodomain [46690] (41 proteins) Pfam PF00046 |
| Protein automated matches [190360] (3 species) not a true protein |
| Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [187191] (6 PDB entries) |
| Domain d3a01f_: 3a01 F: [171619] automated match to d1fjla_ protein/DNA complex |
PDB Entry: 3a01 (more details), 2.7 Å
SCOPe Domain Sequences for d3a01f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3a01f_ a.4.1.1 (F:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
rryrttftsfqleelekafsrthypdvftreelamkiglteariqvwfqnrrakwrkqek
v
Timeline for d3a01f_: